Recombinant Human KCNK13 Full Length Transmembrane protein, His-tagged
| Cat.No. : | KCNK13-1211H |
| Product Overview : | Recombinant Human KCNK13 protein(Q9HB14)(1-408aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-408aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | KCNK13 potassium channel, subfamily K, member 13 [ Homo sapiens ] |
| Official Symbol | KCNK13 |
| Synonyms | KCNK13; potassium channel, subfamily K, member 13; potassium channel subfamily K member 13; K2p13.1; THIK 1; THIK1; K2P13.1 potassium channel; tandem pore domain potassium channel THIK-1; tandem pore domain halothane-inhibited potassium channel 1; THIK-1; |
| Gene ID | 56659 |
| mRNA Refseq | NM_022054 |
| Protein Refseq | NP_071337 |
| MIM | 607367 |
| UniProt ID | Q9HB14 |
| ◆ Cell & Tissue Lysates | ||
| KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK13 Products
Required fields are marked with *
My Review for All KCNK13 Products
Required fields are marked with *



