Recombinant Human KCNK4 protein, GST-tagged

• Cat.No.: KCNK4-301374H
• Product Overview: Recombinant Human KCNK4 (261-393 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser261-Val393
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: SRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KCNK4 potassium channel, subfamily K, member 4 [ Homo sapiens ]
• Official Symbol: KCNK4
• Synonyms: KCNK4; potassium channel, subfamily K, member 4; potassium channel subfamily K member 4; K2p4.1; TRAAK; K2P4.1 potassium channel; two pore K+ channel KT4.1; two pore K(+) channel KT4.1; two pore potassium channel KT4.1; TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK1
• Gene ID: 50801
• mRNA Refseq: NM_033310
• Protein Refseq: NP_201567
• MIM: 605720
• UniProt ID: Q9NYG8