Recombinant Human KCNK4 protein, GST-tagged
Cat.No. : | KCNK4-301374H |
Product Overview : | Recombinant Human KCNK4 (261-393 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser261-Val393 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | SRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | KCNK4 potassium channel, subfamily K, member 4 [ Homo sapiens ] |
Official Symbol | KCNK4 |
Synonyms | KCNK4; potassium channel, subfamily K, member 4; potassium channel subfamily K member 4; K2p4.1; TRAAK; K2P4.1 potassium channel; two pore K+ channel KT4.1; two pore K(+) channel KT4.1; two pore potassium channel KT4.1; TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK1; |
Gene ID | 50801 |
mRNA Refseq | NM_033310 |
Protein Refseq | NP_201567 |
MIM | 605720 |
UniProt ID | Q9NYG8 |
◆ Recombinant Proteins | ||
RFL28481MF | Recombinant Full Length Mouse Potassium Channel Subfamily K Member 4(Kcnk4) Protein, His-Tagged | +Inquiry |
KCNK4-301374H | Recombinant Human KCNK4 protein, GST-tagged | +Inquiry |
RFL2071HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 4(Kcnk4) Protein, His-Tagged | +Inquiry |
KCNK4-8533M | Recombinant Mouse KCNK4 Protein | +Inquiry |
Kcnk4-211M | Recombinant Mouse Kcnk4 protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK4-5034HCL | Recombinant Human KCNK4 293 Cell Lysate | +Inquiry |
KCNK4-323HCL | Recombinant Human KCNK4 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK4 Products
Required fields are marked with *
My Review for All KCNK4 Products
Required fields are marked with *