Recombinant Human KCNK9 Full Length Transmembrane protein, His-tagged

Cat.No. : KCNK9-2228H
Product Overview : Recombinant Human KCNK9 protein(Q9NPC2)(1-374aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-374aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 48.3 kDa
AA Sequence : MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name KCNK9 potassium channel, subfamily K, member 9 [ Homo sapiens ]
Official Symbol KCNK9
Synonyms KCNK9; potassium channel, subfamily K, member 9; potassium channel subfamily K member 9; K2p9.1; TASK 3; TASK3; potassium channel TASK3; two pore K(+) channel KT3.2; two pore potassium channel KT3.2; TWIK-related acid-sensitive K+ channel 3; TWIK-related acid-sensitive K(+) channel 3; acid-sensitive potassium channel protein TASK-3; KT3.2; TASK-3; MGC138268; MGC138270;
Gene ID 51305
mRNA Refseq NM_016601
Protein Refseq NP_057685
MIM 605874
UniProt ID Q9NPC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNK9 Products

Required fields are marked with *

My Review for All KCNK9 Products

Required fields are marked with *

0
cart-icon