Recombinant Human KCNK9 Full Length Transmembrane protein, His-tagged

• Cat.No.: KCNK9-2228H
• Product Overview: Recombinant Human KCNK9 protein(Q9NPC2)(1-374aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-374aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.3 kDa
• AA Sequence: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: KCNK9 potassium channel, subfamily K, member 9 [ Homo sapiens ]
• Official Symbol: KCNK9
• Synonyms: KCNK9; potassium channel, subfamily K, member 9; potassium channel subfamily K member 9; K2p9.1; TASK 3; TASK3; potassium channel TASK3; two pore K(+) channel KT3.2; two pore potassium channel KT3.2; TWIK-related acid-sensitive K+ channel 3; TWIK-related acid-sensitive K(+) channel 3; acid-sensitive potassium channel protein TASK-3; KT3.2; TASK-3; MGC138268; MGC138270
• Gene ID: 51305
• mRNA Refseq: NM_016601
• Protein Refseq: NP_057685
• MIM: 605874
• UniProt ID: Q9NPC2