Recombinant Human KCNK9 Full Length Transmembrane protein, His-tagged
Cat.No. : | KCNK9-2228H |
Product Overview : | Recombinant Human KCNK9 protein(Q9NPC2)(1-374aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-374aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | KCNK9 potassium channel, subfamily K, member 9 [ Homo sapiens ] |
Official Symbol | KCNK9 |
Synonyms | KCNK9; potassium channel, subfamily K, member 9; potassium channel subfamily K member 9; K2p9.1; TASK 3; TASK3; potassium channel TASK3; two pore K(+) channel KT3.2; two pore potassium channel KT3.2; TWIK-related acid-sensitive K+ channel 3; TWIK-related acid-sensitive K(+) channel 3; acid-sensitive potassium channel protein TASK-3; KT3.2; TASK-3; MGC138268; MGC138270; |
Gene ID | 51305 |
mRNA Refseq | NM_016601 |
Protein Refseq | NP_057685 |
MIM | 605874 |
UniProt ID | Q9NPC2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNK9 Products
Required fields are marked with *
My Review for All KCNK9 Products
Required fields are marked with *
0
Inquiry Basket