Recombinant Human KCTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KCTD1-5494H |
Product Overview : | KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KCTD1 potassium channel tetramerisation domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | KCTD1 |
Synonyms | KCTD1; potassium channel tetramerisation domain containing 1; C18orf5; BTB/POZ domain-containing protein KCTD1; potassium channel tetramerization domain-containing protein 1; DKFZp451C132; |
Gene ID | 284252 |
mRNA Refseq | NM_198991 |
Protein Refseq | NP_945342 |
MIM | 613420 |
UniProt ID | Q719H9 |
◆ Recombinant Proteins | ||
Kctd1-316M | Recombinant Mouse Kctd1 Protein, MYC/DDK-tagged | +Inquiry |
KCTD1-5494H | Recombinant Human KCTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD1-0657H | Recombinant Human KCTD1 Protein (S2-D257), His/Strep tagged | +Inquiry |
KCTD1-5786H | Recombinant Human KCTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD1-0656H | Recombinant Human KCTD1 Protein (S2-D257), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD1-5012HCL | Recombinant Human KCTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCTD1 Products
Required fields are marked with *
My Review for All KCTD1 Products
Required fields are marked with *
0
Inquiry Basket