Recombinant Human KCTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCTD1-5494H
• Product Overview: KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome.
• Molecular Mass: 29.4 kDa
• AA Sequence: MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCTD1 potassium channel tetramerisation domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: KCTD1
• Synonyms: KCTD1; potassium channel tetramerisation domain containing 1; C18orf5; BTB/POZ domain-containing protein KCTD1; potassium channel tetramerization domain-containing protein 1; DKFZp451C132
• Gene ID: 284252
• mRNA Refseq: NM_198991
• Protein Refseq: NP_945342
• MIM: 613420
• UniProt ID: Q719H9