Recombinant Human KCTD14 protein, GST-tagged
Cat.No. : | KCTD14-3686H |
Product Overview : | Recombinant Human KCTD14 protein(1-225 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCTD14 potassium channel tetramerisation domain containing 14 [ Homo sapiens ] |
Official Symbol | KCTD14 |
Synonyms | KCTD14; potassium channel tetramerisation domain containing 14; BTB/POZ domain-containing protein KCTD14; MGC2376; |
Gene ID | 65987 |
mRNA Refseq | NM_023930 |
Protein Refseq | NP_076419 |
UniProt ID | Q9BQ13 |
◆ Recombinant Proteins | ||
KCTD14-293H | Recombinant Human KCTD14, His-tagged | +Inquiry |
Kctd14-3666M | Recombinant Mouse Kctd14 Protein, Myc/DDK-tagged | +Inquiry |
KCTD14-3686H | Recombinant Human KCTD14 protein, GST-tagged | +Inquiry |
KCTD14-5189C | Recombinant Chicken KCTD14 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD14-5008HCL | Recombinant Human KCTD14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD14 Products
Required fields are marked with *
My Review for All KCTD14 Products
Required fields are marked with *