Recombinant Human KCTD14 protein, GST-tagged
Cat.No. : | KCTD14-3686H |
Product Overview : | Recombinant Human KCTD14 protein(1-225 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-225 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KCTD14 potassium channel tetramerisation domain containing 14 [ Homo sapiens ] |
Official Symbol | KCTD14 |
Synonyms | KCTD14; potassium channel tetramerisation domain containing 14; BTB/POZ domain-containing protein KCTD14; MGC2376; |
Gene ID | 65987 |
mRNA Refseq | NM_023930 |
Protein Refseq | NP_076419 |
UniProt ID | Q9BQ13 |
◆ Recombinant Proteins | ||
KCTD14-3686H | Recombinant Human KCTD14 protein, GST-tagged | +Inquiry |
Kctd14-3666M | Recombinant Mouse Kctd14 Protein, Myc/DDK-tagged | +Inquiry |
KCTD14-293H | Recombinant Human KCTD14, His-tagged | +Inquiry |
KCTD14-5189C | Recombinant Chicken KCTD14 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD14-5008HCL | Recombinant Human KCTD14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD14 Products
Required fields are marked with *
My Review for All KCTD14 Products
Required fields are marked with *