Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KCTD15-919H |
| Product Overview : | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | KCTD15 (Potassium Channel Tetramerization Domain Containing 15) is a Protein Coding gene. Diseases associated with KCTD15 include Leptin Deficiency Or Dysfunction. Among its related pathways are Sweet Taste Signaling and Hepatic ABC Transporters. An important paralog of this gene is KCTD1. |
| Molecular Mass : | 26.5 kDa |
| AA Sequence : | MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KCTD15 potassium channel tetramerisation domain containing 15 [ Homo sapiens (human) ] |
| Official Symbol | KCTD15 |
| Synonyms | KCTD15; potassium channel tetramerisation domain containing 15; BTB/POZ domain-containing protein KCTD15; MGC25497; MGC2628; |
| Gene ID | 79047 |
| mRNA Refseq | NM_024076 |
| Protein Refseq | NP_076981 |
| MIM | 615240 |
| UniProt ID | Q96SI1 |
| ◆ Recombinant Proteins | ||
| KCTD15-1804H | Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KCTD15-4662H | Recombinant Human KCTD15 protein, GST-tagged | +Inquiry |
| KCTD15-28458TH | Recombinant Human KCTD15, His-tagged | +Inquiry |
| KCTD15-2193R | Recombinant Rhesus Macaque KCTD15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCTD15-2372R | Recombinant Rhesus monkey KCTD15 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCTD15-891HCL | Recombinant Human KCTD15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD15 Products
Required fields are marked with *
My Review for All KCTD15 Products
Required fields are marked with *
