Recombinant Human KCTD15, His-tagged
Cat.No. : | KCTD15-28458TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 95-283 of Human KCTD15 with an N-terminal His Tag, approximately 24kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 95-283 a.a. |
Description : | Potassium channel tetramerisation domain containing 15 also known as BTB/POZ domain-containing protein KCTD15 is protein that in humans is encoded by the KCTD15 gene. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 122 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLL YEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVR VTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGG VDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD |
Sequence Similarities : | Contains 1 BTB (POZ) domain. |
Gene Name | KCTD15 potassium channel tetramerisation domain containing 15 [ Homo sapiens ] |
Official Symbol | KCTD15 |
Synonyms | KCTD15; potassium channel tetramerisation domain containing 15; BTB/POZ domain-containing protein KCTD15; MGC25497; |
Gene ID | 79047 |
mRNA Refseq | NM_001129994 |
Protein Refseq | NP_001123466 |
Uniprot ID | Q96SI1 |
Chromosome Location | 19q13.12 |
Function | voltage-gated potassium channel activity; |
◆ Recombinant Proteins | ||
KCTD15-7111H | Recombinant Human KCTD15, His-tagged | +Inquiry |
Kctd15-3667M | Recombinant Mouse Kctd15 Protein, Myc/DDK-tagged | +Inquiry |
KCTD15-919H | Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD15-1804H | Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD15-28458TH | Recombinant Human KCTD15, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD15-891HCL | Recombinant Human KCTD15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD15 Products
Required fields are marked with *
My Review for All KCTD15 Products
Required fields are marked with *
0
Inquiry Basket