Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KCTD15-1804H |
Product Overview : | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KCTD15 potassium channel tetramerisation domain containing 15 [ Homo sapiens (human) ] |
Official Symbol | KCTD15 |
Synonyms | KCTD15; potassium channel tetramerisation domain containing 15; BTB/POZ domain-containing protein KCTD15; MGC25497; MGC2628; |
Gene ID | 79047 |
mRNA Refseq | NM_001129994 |
Protein Refseq | NP_001123466 |
MIM | 615240 |
UniProt ID | Q96SI1 |
◆ Recombinant Proteins | ||
KCTD15-1804H | Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD15-28458TH | Recombinant Human KCTD15, His-tagged | +Inquiry |
KCTD15-919H | Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD15-4662H | Recombinant Human KCTD15 protein, GST-tagged | +Inquiry |
KCTD15-2372R | Recombinant Rhesus monkey KCTD15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD15-891HCL | Recombinant Human KCTD15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD15 Products
Required fields are marked with *
My Review for All KCTD15 Products
Required fields are marked with *