Recombinant Human KCTD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KCTD2-2457H |
Product Overview : | KCTD2 MS Standard C13 and N15-labeled recombinant protein (NP_056168) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | KCTD2 (Potassium Channel Tetramerization Domain Containing 2) is a Protein Coding gene. Diseases associated with KCTD2 include Dystonia 11, Myoclonic. Among its related pathways are Sweet Taste Signaling and Hepatic ABC Transporters. An important paralog of this gene is KCTD5. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KCTD2 potassium channel tetramerization domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | KCTD2 |
Synonyms | KCTD2; potassium channel tetramerization domain containing 2; BTB/POZ domain-containing protein KCTD2; potassium channel tetramerisation domain containing 2; potassium channel tetramerization domain-containing protein 2 |
Gene ID | 23510 |
mRNA Refseq | NM_015353 |
Protein Refseq | NP_056168 |
MIM | 613422 |
UniProt ID | Q14681 |
◆ Recombinant Proteins | ||
KCTD2-1795C | Recombinant Chicken KCTD2 | +Inquiry |
KCTD2-2457H | Recombinant Human KCTD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCTD2-354H | Recombinant Human KCTD2 Protein, MYC/DDK-tagged | +Inquiry |
KCTD2-4382Z | Recombinant Zebrafish KCTD2 | +Inquiry |
Kctd2-3670M | Recombinant Mouse Kctd2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCTD2 Products
Required fields are marked with *
My Review for All KCTD2 Products
Required fields are marked with *