Recombinant Human KDELC2 protein, His-tagged
Cat.No. : | KDELC2-570H |
Product Overview : | Recombinant Human KDELC2 protein(NP_714916)(250-343 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 250-343 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | VNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSLEERLQLVQLSKENPQLLDAGITGY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KDELC2 KDEL (Lys-Asp-Glu-Leu) containing 2 [ Homo sapiens ] |
Official Symbol | KDELC2 |
Synonyms | KDELC2; KDEL (Lys-Asp-Glu-Leu) containing 2; KDEL motif-containing protein 2; MGC33424; |
Gene ID | 143888 |
mRNA Refseq | NM_153705 |
Protein Refseq | NP_714916 |
UniProt ID | Q7Z4H8 |
◆ Recombinant Proteins | ||
KDELC2-5706Z | Recombinant Zebrafish KDELC2 | +Inquiry |
KDELC2-3233R | Recombinant Rat KDELC2 Protein | +Inquiry |
KDELC2-570H | Recombinant Human KDELC2 protein, His-tagged | +Inquiry |
KDELC2-2889R | Recombinant Rat KDELC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDELC2-5002HCL | Recombinant Human KDELC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDELC2 Products
Required fields are marked with *
My Review for All KDELC2 Products
Required fields are marked with *
0
Inquiry Basket