Recombinant Human KDSR Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KDSR-1510H |
| Product Overview : | KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens (human) ] |
| Official Symbol | KDSR |
| Synonyms | KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1, FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1; FVT-1; KDS reductase; 3-dehydrosphinganine reductase; follicular variant translocation protein 1; follicular lymphoma variant translocation 1; short chain dehydrogenase/reductase family 35C, member 1; FVT1; FLJ36555; FLJ92680; |
| Gene ID | 2531 |
| mRNA Refseq | NM_002035 |
| Protein Refseq | NP_002026 |
| MIM | 136440 |
| UniProt ID | Q06136 |
| ◆ Recombinant Proteins | ||
| RFL29169HF | Recombinant Full Length Human 3-Ketodihydrosphingosine Reductase(Kdsr) Protein, His-Tagged | +Inquiry |
| KDSR-410H | Recombinant Human KDSR Protein, MYC/DDK-tagged | +Inquiry |
| RFL17653MF | Recombinant Full Length Mouse 3-Ketodihydrosphingosine Reductase(Kdsr) Protein, His-Tagged | +Inquiry |
| KDSR-1662H | Recombinant Human KDSR protein, His & GST-tagged | +Inquiry |
| KDSR-26267TH | Recombinant Human KDSR, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDSR Products
Required fields are marked with *
My Review for All KDSR Products
Required fields are marked with *
