Recombinant Human KDSR Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KDSR-1510H
Product Overview : KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.
Molecular Mass : 36.2 kDa
AA Sequence : MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens (human) ]
Official Symbol KDSR
Synonyms KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1, FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1; FVT-1; KDS reductase; 3-dehydrosphinganine reductase; follicular variant translocation protein 1; follicular lymphoma variant translocation 1; short chain dehydrogenase/reductase family 35C, member 1; FVT1; FLJ36555; FLJ92680;
Gene ID 2531
mRNA Refseq NM_002035
Protein Refseq NP_002026
MIM 136440
UniProt ID Q06136

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDSR Products

Required fields are marked with *

My Review for All KDSR Products

Required fields are marked with *

0
cart-icon