Recombinant Human KHK protein, T7-tagged

• Cat.No.: KHK-151H
• Product Overview: Recombinant human KHK ( 298aa, Isoform-a ) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 298 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKW IHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVA GKKCGLQGFDGIV
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: KHK ketohexokinase (fructokinase) [ Homo sapiens ]
• Official Symbol: KHK
• Synonyms: KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase
• Gene ID: 3795
• mRNA Refseq: NM_000221
• Protein Refseq: NP_000212
• MIM: 614058
• UniProt ID: P50053
• Chromosome Location: 2p23.3-p23.2
• Pathway: Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; sucrose degradation V (mammalian), organism-specific biosystem
• Function: ATP binding; ketohexokinase activity; kinase activity; nucleotide binding; transferase activity