Recombinant Human KHK protein, T7-tagged
| Cat.No. : | KHK-151H |
| Product Overview : | Recombinant human KHK ( 298aa, Isoform-a ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 298 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKW IHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVA GKKCGLQGFDGIV |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | KHK ketohexokinase (fructokinase) [ Homo sapiens ] |
| Official Symbol | KHK |
| Synonyms | KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase; |
| Gene ID | 3795 |
| mRNA Refseq | NM_000221 |
| Protein Refseq | NP_000212 |
| MIM | 614058 |
| UniProt ID | P50053 |
| Chromosome Location | 2p23.3-p23.2 |
| Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; sucrose degradation V (mammalian), organism-specific biosystem; |
| Function | ATP binding; ketohexokinase activity; kinase activity; nucleotide binding; transferase activity; |
| ◆ Recombinant Proteins | ||
| KHK-450H | Active Recombinant Human KHK, His-tagged | +Inquiry |
| Khk-1263M | Recombinant Mouse Khk Protein, MYC/DDK-tagged | +Inquiry |
| KHK-905H | Recombinant Human Ketohexokinase (fructokinase) | +Inquiry |
| KHK-3586HFL | Recombinant Full Length Human KHK, Flag-tagged | +Inquiry |
| KHK-2902R | Recombinant Rat KHK Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KHK Products
Required fields are marked with *
My Review for All KHK Products
Required fields are marked with *
