Recombinant Human KHK protein, T7-tagged
Cat.No. : | KHK-151H |
Product Overview : | Recombinant human KHK ( 298aa, Isoform-a ) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 298 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKW IHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVA GKKCGLQGFDGIV |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | KHK ketohexokinase (fructokinase) [ Homo sapiens ] |
Official Symbol | KHK |
Synonyms | KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase; |
Gene ID | 3795 |
mRNA Refseq | NM_000221 |
Protein Refseq | NP_000212 |
MIM | 614058 |
UniProt ID | P50053 |
Chromosome Location | 2p23.3-p23.2 |
Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; sucrose degradation V (mammalian), organism-specific biosystem; |
Function | ATP binding; ketohexokinase activity; kinase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
KHK-493H | Recombinant Human KHK protein, His-tagged | +Inquiry |
KHK-29893TH | Recombinant Human KHK | +Inquiry |
KHK-4800M | Recombinant Mouse KHK Protein, His (Fc)-Avi-tagged | +Inquiry |
KHK-905H | Recombinant Human Ketohexokinase (fructokinase) | +Inquiry |
KHK-29896TH | Recombinant Human KHK, T7 -tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KHK Products
Required fields are marked with *
My Review for All KHK Products
Required fields are marked with *