Recombinant Human KHK protein, T7-tagged

Cat.No. : KHK-151H
Product Overview : Recombinant human KHK ( 298aa, Isoform-a ) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 298 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKW IHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVA GKKCGLQGFDGIV
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name KHK ketohexokinase (fructokinase) [ Homo sapiens ]
Official Symbol KHK
Synonyms KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase;
Gene ID 3795
mRNA Refseq NM_000221
Protein Refseq NP_000212
MIM 614058
UniProt ID P50053
Chromosome Location 2p23.3-p23.2
Pathway Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; sucrose degradation V (mammalian), organism-specific biosystem;
Function ATP binding; ketohexokinase activity; kinase activity; nucleotide binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KHK Products

Required fields are marked with *

My Review for All KHK Products

Required fields are marked with *

0
cart-icon