Recombinant Human KIAA0649 protein, GST-tagged
| Cat.No. : | KIAA0649-301407H |
| Product Overview : | Recombinant Human KIAA0649 (216-456 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Val216-Pro456 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | VSSDDSFEQSIRAEIEQFLNEKRQHETQKCDGSVEKKPDTNENSAKSLLKSHQEPPTKVVHRQGLLGVQKEFAFRKPPRLAKMNVQPRSLRSKVTTTQENEGSTKPATPCRPSEAAQNKGGIKRSASAARRGKRVMSAAQASEASDSSSDDGIEEAIQLYQLQKTRKEADGDLPQRVQLREERAPDPPAHSTSSATKSALPETHRKTPSKKKLVATKTMDPGPGGLDTDHAPKLLKETKAP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PPP1R26 protein phosphatase 1 regulatory subunit 26 [ Homo sapiens (human) ] |
| Official Symbol | KIAA0649 |
| Synonyms | PPP1R26; NRBE3; KIAA0649 |
| Gene ID | 9858 |
| mRNA Refseq | NM_014811 |
| Protein Refseq | NP_055626 |
| MIM | 614056 |
| UniProt ID | Q5T8A7 |
| ◆ Recombinant Proteins | ||
| KIAA0649-2394R | Recombinant Rhesus monkey KIAA0649 Protein, His-tagged | +Inquiry |
| KIAA0649-301407H | Recombinant Human KIAA0649 protein, GST-tagged | +Inquiry |
| KIAA0649-2215R | Recombinant Rhesus Macaque KIAA0649 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KIAA0649-4003H | Recombinant Human KIAA0649 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIAA0649-4971HCL | Recombinant Human KIAA0649 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA0649 Products
Required fields are marked with *
My Review for All KIAA0649 Products
Required fields are marked with *



