Recombinant Human KIAA1143 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KIAA1143-5390H
Product Overview : KIAA1143 MS Standard C13 and N15-labeled recombinant protein (NP_065747) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : KIAA1143 (KIAA1143) is a Protein Coding gene.
Molecular Mass : 17.5 kDa
AA Sequence : MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KIAA1143 KIAA1143 [ Homo sapiens (human) ]
Official Symbol KIAA1143
Synonyms KIAA1143; uncharacterized protein KIAA1143;
Gene ID 57456
mRNA Refseq NM_020696
Protein Refseq NP_065747
UniProt ID Q96AT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIAA1143 Products

Required fields are marked with *

My Review for All KIAA1143 Products

Required fields are marked with *

0
cart-icon
0
compare icon