Recombinant Human KIAA1143 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KIAA1143-5390H |
Product Overview : | KIAA1143 MS Standard C13 and N15-labeled recombinant protein (NP_065747) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | KIAA1143 (KIAA1143) is a Protein Coding gene. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KIAA1143 KIAA1143 [ Homo sapiens (human) ] |
Official Symbol | KIAA1143 |
Synonyms | KIAA1143; uncharacterized protein KIAA1143; |
Gene ID | 57456 |
mRNA Refseq | NM_020696 |
Protein Refseq | NP_065747 |
UniProt ID | Q96AT1 |
◆ Recombinant Proteins | ||
KIAA1143-5390H | Recombinant Human KIAA1143 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KIAA1143-1512C | Recombinant Chicken KIAA1143 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA1143-4968HCL | Recombinant Human KIAA1143 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA1143 Products
Required fields are marked with *
My Review for All KIAA1143 Products
Required fields are marked with *