Recombinant Human KIAA1143 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KIAA1143-5390H
• Product Overview: KIAA1143 MS Standard C13 and N15-labeled recombinant protein (NP_065747) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: KIAA1143 (KIAA1143) is a Protein Coding gene.
• Molecular Mass: 17.5 kDa
• AA Sequence: MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KIAA1143 KIAA1143 [ Homo sapiens (human) ]
• Official Symbol: KIAA1143
• Synonyms: KIAA1143; uncharacterized protein KIAA1143
• Gene ID: 57456
• mRNA Refseq: NM_020696
• Protein Refseq: NP_065747
• UniProt ID: Q96AT1