Recombinant Human KIAA1191 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KIAA1191-5696H
Product Overview : KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.
Molecular Mass : 33.2 kDa
AA Sequence : MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KIAA1191 KIAA1191 [ Homo sapiens (human) ]
Official Symbol KIAA1191
Synonyms KIAA1191; UPF0498 protein KIAA1191; FLJ21022; brain-derived rescue factor p60MONOX; p60MONOX;
Gene ID 57179
mRNA Refseq NM_020444
Protein Refseq NP_065177
UniProt ID Q96A73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIAA1191 Products

Required fields are marked with *

My Review for All KIAA1191 Products

Required fields are marked with *

0
cart-icon
0
compare icon