Recombinant Human KIAA1191 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KIAA1191-5696H |
| Product Overview : | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth. |
| Molecular Mass : | 33.2 kDa |
| AA Sequence : | MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KIAA1191 KIAA1191 [ Homo sapiens (human) ] |
| Official Symbol | KIAA1191 |
| Synonyms | KIAA1191; UPF0498 protein KIAA1191; FLJ21022; brain-derived rescue factor p60MONOX; p60MONOX; |
| Gene ID | 57179 |
| mRNA Refseq | NM_020444 |
| Protein Refseq | NP_065177 |
| UniProt ID | Q96A73 |
| ◆ Recombinant Proteins | ||
| KIAA1191-2321C | Recombinant Chicken KIAA1191 | +Inquiry |
| KIAA1191-5696H | Recombinant Human KIAA1191 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIAA1191-4966HCL | Recombinant Human KIAA1191 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIAA1191 Products
Required fields are marked with *
My Review for All KIAA1191 Products
Required fields are marked with *
