Recombinant Human KIAA1191 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KIAA1191-5696H
• Product Overview: KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.
• Molecular Mass: 33.2 kDa
• AA Sequence: MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KIAA1191 KIAA1191 [ Homo sapiens (human) ]
• Official Symbol: KIAA1191
• Synonyms: KIAA1191; UPF0498 protein KIAA1191; FLJ21022; brain-derived rescue factor p60MONOX; p60MONOX
• Gene ID: 57179
• mRNA Refseq: NM_020444
• Protein Refseq: NP_065177
• UniProt ID: Q96A73