Recombinant Human KIDINS220, His-tagged
Cat.No. : | KIDINS220-26700TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1604-1771 of Human Kidins220 with an N terminal His tag.MW 38 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1604-1771 a.a. |
Conjugation : | HIS |
Tissue specificity : | Abundant in developing and adult neural tissues as well as neuroendocrine cells and dendritic cells. Overexpressed in melanoma and melanoma cell lines. |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARM SICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTPS TVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSP NPTTIQNENLKSMTHKRSQRSSYTRLSKDPPELHAAASSE STGFGEERESIL |
Sequence Similarities : | Contains 12 ANK repeats.Contains 1 KAP NTPase domain. |
Gene Name | KIDINS220 kinase D-interacting substrate, 220kDa [ Homo sapiens ] |
Official Symbol | KIDINS220 |
Synonyms | KIDINS220; kinase D-interacting substrate, 220kDa; kinase D-interacting substrate of 220 kDa; ankyrin repeat rich membrane spanning protein; ARMS; |
Gene ID | 57498 |
mRNA Refseq | NM_020738 |
Protein Refseq | NP_065789 |
Uniprot ID | Q9ULH0 |
Chromosome Location | 2p24 |
Pathway | ARMS-mediated activation, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; Prolonged ERK activation events, organism-specific biosystem; |
◆ Recombinant Proteins | ||
KIDINS220-2905R | Recombinant Rat KIDINS220 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIDINS220-26700TH | Recombinant Human KIDINS220, His-tagged | +Inquiry |
KIDINS220-3249R | Recombinant Rat KIDINS220 Protein | +Inquiry |
KIDINS220-32H | Recombinant Human KIDINS220 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIDINS220 Products
Required fields are marked with *
My Review for All KIDINS220 Products
Required fields are marked with *
0
Inquiry Basket