Recombinant Human KIF20B Protein, GST-tagged
Cat.No. : | KIF20B-5496H |
Product Overview : | Human MPHOSPH1 partial ORF ( NP_057279, 1671 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | KIF20B (Kinesin Family Member 20B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Golgi-to-ER retrograde transport. GO annotations related to this gene include ATPase activity and microtubule motor activity. An important paralog of this gene is KIF20A. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KIF20B kinesin family member 20B [ Homo sapiens (human) ] |
Official Symbol | KIF20B |
Synonyms | KIF20B; kinesin family member 20B; CT90; MPP1; KRMP1; MPP-1; MPHOSPH1; kinesin-like protein KIF20B; M-phase phosphoprotein 1; cancer/testis antigen 90; kinesin-related motor interacting with PIN1; mitotic kinesin-like protein; mitotic kinesin-related protein |
Gene ID | 9585 |
mRNA Refseq | NM_001284259 |
Protein Refseq | NP_001271188 |
MIM | 605498 |
UniProt ID | Q96Q89 |
◆ Recombinant Proteins | ||
KIF20B-8631M | Recombinant Mouse KIF20B Protein | +Inquiry |
KIF20B-301305H | Recombinant Human KIF20B protein, GST-tagged | +Inquiry |
KIF20B-4810M | Recombinant Mouse KIF20B Protein, His (Fc)-Avi-tagged | +Inquiry |
KIF20B-5496H | Recombinant Human KIF20B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIF20B Products
Required fields are marked with *
My Review for All KIF20B Products
Required fields are marked with *
0
Inquiry Basket