Recombinant Human KIF21A protein, GST-tagged

Cat.No. : KIF21A-3717H
Product Overview : Recombinant Human KIF21A protein(1125-1230 aa), fused to GST tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1125-1230 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KIF21A kinesin family member 21A [ Homo sapiens ]
Official Symbol KIF21A
Synonyms KIF21A; kinesin family member 21A; FEOM1, fibrosis of the extraocular muscles, congenital, 1; kinesin-like protein KIF21A; FLJ20052; kinesin-like protein KIF2; renal carcinoma antigen NY-REN-62; FEOM1; CFEOM1; FEOM3A; KIAA1708; DKFZp779C159;
Gene ID 55605
mRNA Refseq NM_001173463
Protein Refseq NP_001166934
MIM 608283
UniProt ID Q7Z4S6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIF21A Products

Required fields are marked with *

My Review for All KIF21A Products

Required fields are marked with *

0
cart-icon