Recombinant Human KIF21A protein, GST-tagged
| Cat.No. : | KIF21A-3717H |
| Product Overview : | Recombinant Human KIF21A protein(1125-1230 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1125-1230 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KIF21A kinesin family member 21A [ Homo sapiens ] |
| Official Symbol | KIF21A |
| Synonyms | KIF21A; kinesin family member 21A; FEOM1, fibrosis of the extraocular muscles, congenital, 1; kinesin-like protein KIF21A; FLJ20052; kinesin-like protein KIF2; renal carcinoma antigen NY-REN-62; FEOM1; CFEOM1; FEOM3A; KIAA1708; DKFZp779C159; |
| Gene ID | 55605 |
| mRNA Refseq | NM_001173463 |
| Protein Refseq | NP_001166934 |
| MIM | 608283 |
| UniProt ID | Q7Z4S6 |
| ◆ Recombinant Proteins | ||
| KIF21A-3717H | Recombinant Human KIF21A protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIF21A-4949HCL | Recombinant Human KIF21A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF21A Products
Required fields are marked with *
My Review for All KIF21A Products
Required fields are marked with *
