Recombinant Human KIF23 protein, GST-tagged
Cat.No. : | KIF23-3692H |
Product Overview : | Recombinant Human KIF23 protein(486-683 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 486-683 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KIF23 kinesin family member 23 [ Homo sapiens ] |
Official Symbol | KIF23 |
Synonyms | KIF23; kinesin family member 23; kinesin like 5 (mitotic kinesin like protein 1) , KNSL5; kinesin-like protein KIF23; MKLP 1; MKLP1; kinesin-like protein 5; mitotic kinesin-like 1; mitotic kinesin-like protein 1; kinesin-like 5 (mitotic kinesin-like protein 1); CHO1; KNSL5; MKLP-1; |
Gene ID | 9493 |
mRNA Refseq | NM_004856 |
Protein Refseq | NP_004847 |
MIM | 605064 |
UniProt ID | Q02241 |
◆ Recombinant Proteins | ||
KIF23-8935Z | Recombinant Zebrafish KIF23 | +Inquiry |
KIF23-2268C | Recombinant Chicken KIF23 | +Inquiry |
KIF23-3692H | Recombinant Human KIF23 protein, GST-tagged | +Inquiry |
KIF23-8635M | Recombinant Mouse KIF23 Protein | +Inquiry |
KIF23-4812M | Recombinant Mouse KIF23 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF23-928HCL | Recombinant Human KIF23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF23 Products
Required fields are marked with *
My Review for All KIF23 Products
Required fields are marked with *
0
Inquiry Basket