Recombinant Human KIF23 protein, GST-tagged

Cat.No. : KIF23-3692H
Product Overview : Recombinant Human KIF23 protein(486-683 aa), fused to GST tag, was expressed in E. coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 486-683 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KIF23 kinesin family member 23 [ Homo sapiens ]
Official Symbol KIF23
Synonyms KIF23; kinesin family member 23; kinesin like 5 (mitotic kinesin like protein 1) , KNSL5; kinesin-like protein KIF23; MKLP 1; MKLP1; kinesin-like protein 5; mitotic kinesin-like 1; mitotic kinesin-like protein 1; kinesin-like 5 (mitotic kinesin-like protein 1); CHO1; KNSL5; MKLP-1;
Gene ID 9493
mRNA Refseq NM_004856
Protein Refseq NP_004847
MIM 605064
UniProt ID Q02241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIF23 Products

Required fields are marked with *

My Review for All KIF23 Products

Required fields are marked with *

0
cart-icon
0
compare icon