Recombinant Human KIF23 protein, GST-tagged
| Cat.No. : | KIF23-3692H |
| Product Overview : | Recombinant Human KIF23 protein(486-683 aa), fused to GST tag, was expressed in E. coli. |
| Availability | September 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 486-683 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KIF23 kinesin family member 23 [ Homo sapiens ] |
| Official Symbol | KIF23 |
| Synonyms | KIF23; kinesin family member 23; kinesin like 5 (mitotic kinesin like protein 1) , KNSL5; kinesin-like protein KIF23; MKLP 1; MKLP1; kinesin-like protein 5; mitotic kinesin-like 1; mitotic kinesin-like protein 1; kinesin-like 5 (mitotic kinesin-like protein 1); CHO1; KNSL5; MKLP-1; |
| Gene ID | 9493 |
| mRNA Refseq | NM_004856 |
| Protein Refseq | NP_004847 |
| MIM | 605064 |
| UniProt ID | Q02241 |
| ◆ Recombinant Proteins | ||
| KIF23-4812M | Recombinant Mouse KIF23 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KIF23-8935Z | Recombinant Zebrafish KIF23 | +Inquiry |
| KIF23-3692H | Recombinant Human KIF23 protein, GST-tagged | +Inquiry |
| KIF23-8635M | Recombinant Mouse KIF23 Protein | +Inquiry |
| KIF23-2268C | Recombinant Chicken KIF23 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIF23-220HKCL | Human KIF23 Knockdown Cell Lysate | +Inquiry |
| KIF23-928HCL | Recombinant Human KIF23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF23 Products
Required fields are marked with *
My Review for All KIF23 Products
Required fields are marked with *
