Recombinant Human KIF23 protein, GST-tagged

• Cat.No.: KIF23-3692H
• Product Overview: Recombinant Human KIF23 protein(486-683 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 486-683 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KIF23 kinesin family member 23 [ Homo sapiens ]
• Official Symbol: KIF23
• Synonyms: KIF23; kinesin family member 23; kinesin like 5 (mitotic kinesin like protein 1) , KNSL5; kinesin-like protein KIF23; MKLP 1; MKLP1; kinesin-like protein 5; mitotic kinesin-like 1; mitotic kinesin-like protein 1; kinesin-like 5 (mitotic kinesin-like protein 1); CHO1; KNSL5; MKLP-1
• Gene ID: 9493
• mRNA Refseq: NM_004856
• Protein Refseq: NP_004847
• MIM: 605064
• UniProt ID: Q02241