Recombinant Human KIF2A protein, GST-tagged
| Cat.No. : | KIF2A-6743H |
| Product Overview : | Recombinant Human KIF2A protein(528-679 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 528-679 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | VDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | KIF2A kinesin heavy chain member 2A [ Homo sapiens ] |
| Official Symbol | KIF2A |
| Synonyms | KIF2A; kinesin heavy chain member 2A; KIF2, kinesin heavy chain member 2; kinesin-like protein KIF2A; HK2; kinesin-2; Kinesin, heavy chain, 2; KIF2; |
| mRNA Refseq | NM_001098511 |
| Protein Refseq | NP_001091981 |
| MIM | 602591 |
| UniProt ID | O00139 |
| Gene ID | 3796 |
| ◆ Recombinant Proteins | ||
| KIF2A-6744H | Recombinant Human KIF2A protein, GST-tagged | +Inquiry |
| KIF2A-2226R | Recombinant Rhesus Macaque KIF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| KIF2A-6743H | Recombinant Human KIF2A protein, GST-tagged | +Inquiry |
| KIF2A-2405R | Recombinant Rhesus monkey KIF2A Protein, His-tagged | +Inquiry |
| KIF2A-4815M | Recombinant Mouse KIF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIF2A-4947HCL | Recombinant Human KIF2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF2A Products
Required fields are marked with *
My Review for All KIF2A Products
Required fields are marked with *
