Recombinant Human KIF5C protein, GST-tagged

• Cat.No.: KIF5C-301171H
• Product Overview: Recombinant Human KIF5C (143-194 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ala143-Arg194
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KIF5C kinesin family member 5C [ Homo sapiens ]
• Official Symbol: KIF5C
• Synonyms: KIF5C; kinesin family member 5C; kinesin heavy chain isoform 5C; kinesin heavy chain neuron-specific 2; kinesin, heavy chain, neuron-specific; KINN; NKHC; NKHC2; NKHC-2; FLJ44735; KIAA0531; MGC111478
• Gene ID: 3800
• mRNA Refseq: NM_004522
• Protein Refseq: NP_004513
• MIM: 604593
• UniProt ID: O60282