Recombinant Human KIF5C protein, GST-tagged

Cat.No. : KIF5C-301171H
Product Overview : Recombinant Human KIF5C (143-194 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ala143-Arg194
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name KIF5C kinesin family member 5C [ Homo sapiens ]
Official Symbol KIF5C
Synonyms KIF5C; kinesin family member 5C; kinesin heavy chain isoform 5C; kinesin heavy chain neuron-specific 2; kinesin, heavy chain, neuron-specific; KINN; NKHC; NKHC2; NKHC-2; FLJ44735; KIAA0531; MGC111478;
Gene ID 3800
mRNA Refseq NM_004522
Protein Refseq NP_004513
MIM 604593
UniProt ID O60282

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KIF5C Products

Required fields are marked with *

My Review for All KIF5C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon