Recombinant Human KIF5C protein, GST-tagged
Cat.No. : | KIF5C-301171H |
Product Overview : | Recombinant Human KIF5C (143-194 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala143-Arg194 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | KIF5C kinesin family member 5C [ Homo sapiens ] |
Official Symbol | KIF5C |
Synonyms | KIF5C; kinesin family member 5C; kinesin heavy chain isoform 5C; kinesin heavy chain neuron-specific 2; kinesin, heavy chain, neuron-specific; KINN; NKHC; NKHC2; NKHC-2; FLJ44735; KIAA0531; MGC111478; |
Gene ID | 3800 |
mRNA Refseq | NM_004522 |
Protein Refseq | NP_004513 |
MIM | 604593 |
UniProt ID | O60282 |
◆ Recombinant Proteins | ||
KIF5C-301171H | Recombinant Human KIF5C protein, GST-tagged | +Inquiry |
KIF5C-8649M | Recombinant Mouse KIF5C Protein | +Inquiry |
KIF5C-555H | Recombinant Human KIF5C Protein, MYC/DDK-tagged | +Inquiry |
KIF5C-3946H | Recombinant Human KIF5C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Kif5c-1270M | Recombinant Mouse Kif5c Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIF5C Products
Required fields are marked with *
My Review for All KIF5C Products
Required fields are marked with *
0
Inquiry Basket