Recombinant Human KIF6 protein, GST-tagged

• Cat.No.: KIF6-1222H
• Product Overview: Recombinant Human KIF6 protein(1-266 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-266 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: GMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KIF6 kinesin family member 6 [ Homo sapiens ]
• Official Symbol: KIF6
• Synonyms: KIF6; kinesin family member 6; C6orf102, chromosome 6 open reading frame 102; kinesin-like protein KIF6; dJ137F1.4; dJ188D3.1; dJ1043E3.1; DKFZp451I2418; MGC33317; C6orf102
• Gene ID: 221458
• mRNA Refseq: NM_145027
• Protein Refseq: NP_659464
• MIM: 613919
• UniProt ID: Q6ZMV9