Recombinant Human KIF6 protein, GST-tagged
Cat.No. : | KIF6-1222H |
Product Overview : | Recombinant Human KIF6 protein(1-266 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-266 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KIF6 kinesin family member 6 [ Homo sapiens ] |
Official Symbol | KIF6 |
Synonyms | KIF6; kinesin family member 6; C6orf102, chromosome 6 open reading frame 102; kinesin-like protein KIF6; dJ137F1.4; dJ188D3.1; dJ1043E3.1; DKFZp451I2418; MGC33317; C6orf102; |
Gene ID | 221458 |
mRNA Refseq | NM_145027 |
Protein Refseq | NP_659464 |
MIM | 613919 |
UniProt ID | Q6ZMV9 |
◆ Recombinant Proteins | ||
KIF6-2112H | Recombinant Human KIF6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KIF6-4726Z | Recombinant Zebrafish KIF6 | +Inquiry |
KIF6-1222H | Recombinant Human KIF6 protein, GST-tagged | +Inquiry |
Kif6-3694M | Recombinant Mouse Kif6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF6-932HCL | Recombinant Human KIF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF6 Products
Required fields are marked with *
My Review for All KIF6 Products
Required fields are marked with *