Recombinant Human KIFC1 protein, GST-tagged
| Cat.No. : | KIFC1-42H |
| Product Overview : | Recombinant Human KIFC1(1 a.a. - 673 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-673 a.a. |
| Description : | KIFC1 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 100.1 kDa |
| AA Sequence : | MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTV PQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLKGQLCDLNAEL KRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEG LVQELQKKQVELQEERRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTLSGAPAPPPRHDFSFD RVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQELSG QGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRA VARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQANRK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | KIFC1 kinesin family member C1 [ Homo sapiens ] |
| Official Symbol | KIFC1 |
| Synonyms | KIFC1; kinesin family member C1; kinesin like 2 , KNSL2; kinesin-like protein KIFC1; HSET; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET; KNSL2; MGC1202; MGC149736; MGC149737; |
| Gene ID | 3833 |
| mRNA Refseq | NM_002263 |
| Protein Refseq | NP_002254 |
| MIM | 603763 |
| UniProt ID | Q9BW19 |
| Chromosome Location | 6p21.32 |
| Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem; |
| Function | ATP binding; microtubule motor activity; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| KIFC1-0688H | Recombinant Human KIFC1 Protein (Q305-K673), His tagged | +Inquiry |
| KIFC1-4824M | Recombinant Mouse KIFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KIFC1-8654M | Recombinant Mouse KIFC1 Protein | +Inquiry |
| KIFC1-8807Z | Recombinant Zebrafish KIFC1 | +Inquiry |
| KIFC1-43H | Recombinant Human KIFC1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIFC1-363HCL | Recombinant Human KIFC1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIFC1 Products
Required fields are marked with *
My Review for All KIFC1 Products
Required fields are marked with *
