Recombinant Human KIR2DL2 Protein, C-His-tagged
Cat.No. : | KIR2DL2-081H |
Product Overview : | Recombinant Human KIR2DL2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C. |
Molecular Mass : | ~25 kDa |
AA Sequence : | HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR2DL2 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ] |
Official Symbol | KIR2DL2 |
Synonyms | KIR2DL2; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 2DL2; CD158B1; CD158k; cl 43; nkat6; NKAT-6; p58 NK receptor CL-43; MHC class I NK cell receptor; CD158 antigen-like family member B1; natural killer-associated transcript 6; p58 natural killer cell receptor clone CL-43; NKAT6; p58.2; CD158b; |
Gene ID | 3803 |
mRNA Refseq | NM_014219 |
Protein Refseq | NP_055034 |
MIM | 604937 |
UniProt ID | P43627 |
◆ Recombinant Proteins | ||
KIR2DL2-4337H | Recombinant Human KIR2DL2 Protein (Met1-His245), C-His tagged | +Inquiry |
KIR2DL2-0317H | Active Recombinant Human KIR2DL2 protein, Fc-tagged | +Inquiry |
KIR2DL2-13H | Recombinant Human KIR2DL2 protein, Fc-tagged, Biotin-labeled | +Inquiry |
KIR2DL2-627HB | Recombinant Human KIR2DL2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL5473HF | Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Dl2(Kir2Dl2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR2DL2 Products
Required fields are marked with *
My Review for All KIR2DL2 Products
Required fields are marked with *
0
Inquiry Basket