Recombinant Human KIR2DS1 Protein (22-245 aa), His-tagged

Cat.No. : KIR2DS1-1014H
Product Overview : Recombinant Human KIR2DS1 Protein (22-245 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-245 aa
Description : Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 28.8 kDa
AA Sequence : HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 [ Homo sapiens ]
Official Symbol KIR2DS1
Synonyms KIR2DS1; CD158H; EB6ActI; EB6ActII; KIR2DL1-KIR2DS1; p50.1; CD158a;
Gene ID 3806
mRNA Refseq NM_014512
Protein Refseq NP_055327
MIM 604952
UniProt ID Q14954

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DS1 Products

Required fields are marked with *

My Review for All KIR2DS1 Products

Required fields are marked with *

0
cart-icon