Recombinant Human KIR3DL2 Protein (22-340aa), C-hIgG-His tagged
Cat.No. : | KIR3DL2-13H |
Product Overview : | Recombinant human KIR3DL2 (22-340aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 22-340aa |
Description : | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | Liquid |
Molecular Mass : | 62.2 kDa (561aa) |
AA Sequence : | < ADP> LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH< VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH> |
Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
Purity : | > 85% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | KIR3DL2 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ] |
Official Symbol | KIR3DL2 |
Synonyms | KIR3DL2; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 3DL2; CD158K; cl 5; nkat4; nkat4a; nkat4b; KIR antigen 3DL2; killer Ig receptor; p70 NK receptor CL-5; MHC class I NK cell receptor; CD158 antigen-like family member K; p70 killer cell inhibitory receptor; natural killer-associated transcript 4; natural killer cell inhibitory receptor; p70 natural killer cell receptor clone CL-5; killer cell immunoglobulin-like receptor KIR3DL2; p140; NKAT4; NKAT-4; NKAT4B; MGC125321; |
Gene ID | 3812 |
mRNA Refseq | NM_006737 |
Protein Refseq | NP_006728 |
MIM | 604947 |
UniProt ID | P43630 |
◆ Recombinant Proteins | ||
KIR3DL2-3291H | Active Recombinant Human KIR3DL2 protein, His-Avi-tagged | +Inquiry |
KIR3DL2-3292R | Recombinant Rhesus macaque KIR3DL2 protein, His-tagged | +Inquiry |
KIR3DL2-5708H | Recombinant Human KIR3DL2 protein, His & GST-tagged | +Inquiry |
KIR3DL2-5669H | Active Recombinant Human Killer Cell Immunoglobulin-Like Receptor, Three Domains, Long Cytoplasmic Tail, 2, Fc-tagged | +Inquiry |
KIR3DL2-1576R | Recombinant Rhesus macaque KIR3DL2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR3DL2-4938HCL | Recombinant Human KIR3DL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR3DL2 Products
Required fields are marked with *
My Review for All KIR3DL2 Products
Required fields are marked with *
0
Inquiry Basket