Recombinant Human KIR3DL3 Protein, C-His-tagged
Cat.No. : | KIR3DL3-234H |
Product Overview : | Recombinant Human KIR3DL3 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | KIR3DL3, receptor on natural killer cells. May inhibit the activity of NK cells thus preventing cell lysis. |
Molecular Mass : | ~33 kDa |
AA Sequence : | QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR3DL3 killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 [ Homo sapiens (human) ] |
Official Symbol | KIR3DL3 |
Synonyms | KIR3DL3; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3; KIR44; KIRC1; CD158Z; KIR3DL7; KIR2DL5B; killer cell immunoglobulin-like receptor 3DL3; CD158 antigen-like family member Z; KIR2DL5B*011; KIR2DS2*00101; KIR2DS2*00101-v; KIR2DS2*00102; KIR2DS2*00105; KIR2DS2*004; KIR3DL3 Killer-cell Immunoglobulin-like Receptor; KIR3DL3*00301; KIR3DL3*00402; KIR3DL3*00701; KIR3DL3*00802; KIR3DL3*00901; KIR3DL3*012; KIR3DL3*01402; KIR3DL3*01403; KIR3DL3*01403-v; KIR3DL3*01404; KIR3DL3*01406; KIR3DL3*01601; KIR3DL3*020; KIR3DL3*02801; KIR3DL3*034; KIR3DL3*050; KIR3DL3*071-v; killer cell Ig-like receptor KIR3DL7; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 3; killer cell inhibitory receptor 1; killer-cell immunoglobulin-like receptor 3DL3 |
Gene ID | 115653 |
mRNA Refseq | NM_153443 |
Protein Refseq | NP_703144 |
MIM | 610095 |
UniProt ID | Q8N743 |
◆ Recombinant Proteins | ||
KIR3DL3-1937H | Recombinant Human KIR3DL3 protein, Fc-tagged | +Inquiry |
KIR3DL3-743H | Recombinant Human KIR3DL3 protein, His-Avi-tagged | +Inquiry |
KIR3DL3-3801H | Recombinant Human KIR3DL3 Protein (Met1-Leu322), C-His tagged | +Inquiry |
KIR3DL3-758H | Recombinant Human KIR3DL3 Protein, His-tagged | +Inquiry |
KIR3DL3-234H | Recombinant Human KIR3DL3 Protein, C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR3DL3 Products
Required fields are marked with *
My Review for All KIR3DL3 Products
Required fields are marked with *
0
Inquiry Basket