Recombinant Human KIR3DL3 Protein, C-His-tagged

Cat.No. : KIR3DL3-234H
Product Overview : Recombinant Human KIR3DL3 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : KIR3DL3, receptor on natural killer cells. May inhibit the activity of NK cells thus preventing cell lysis.
Molecular Mass : ~33 kDa
AA Sequence : QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR3DL3 killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 [ Homo sapiens (human) ]
Official Symbol KIR3DL3
Synonyms KIR3DL3; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3; KIR44; KIRC1; CD158Z; KIR3DL7; KIR2DL5B; killer cell immunoglobulin-like receptor 3DL3; CD158 antigen-like family member Z; KIR2DL5B*011; KIR2DS2*00101; KIR2DS2*00101-v; KIR2DS2*00102; KIR2DS2*00105; KIR2DS2*004; KIR3DL3 Killer-cell Immunoglobulin-like Receptor; KIR3DL3*00301; KIR3DL3*00402; KIR3DL3*00701; KIR3DL3*00802; KIR3DL3*00901; KIR3DL3*012; KIR3DL3*01402; KIR3DL3*01403; KIR3DL3*01403-v; KIR3DL3*01404; KIR3DL3*01406; KIR3DL3*01601; KIR3DL3*020; KIR3DL3*02801; KIR3DL3*034; KIR3DL3*050; KIR3DL3*071-v; killer cell Ig-like receptor KIR3DL7; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 3; killer cell inhibitory receptor 1; killer-cell immunoglobulin-like receptor 3DL3
Gene ID 115653
mRNA Refseq NM_153443
Protein Refseq NP_703144
MIM 610095
UniProt ID Q8N743

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR3DL3 Products

Required fields are marked with *

My Review for All KIR3DL3 Products

Required fields are marked with *

0
cart-icon