Recombinant Human KIR3DL3 Protein, C-His-tagged

• Cat.No.: KIR3DL3-234H
• Product Overview: Recombinant Human KIR3DL3 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: KIR3DL3, receptor on natural killer cells. May inhibit the activity of NK cells thus preventing cell lysis.
• Molecular Mass: ~33 kDa
• AA Sequence: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR3DL3 killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 [ Homo sapiens (human) ]
• Official Symbol: KIR3DL3
• Synonyms: KIR3DL3; killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3; KIR44; KIRC1; CD158Z; KIR3DL7; KIR2DL5B; killer cell immunoglobulin-like receptor 3DL3; CD158 antigen-like family member Z; KIR2DL5B*011; KIR2DS2*00101; KIR2DS2*00101-v; KIR2DS2*00102; KIR2DS2*00105; KIR2DS2*004; KIR3DL3 Killer-cell Immunoglobulin-like Receptor; KIR3DL3*00301; KIR3DL3*00402; KIR3DL3*00701; KIR3DL3*00802; KIR3DL3*00901; KIR3DL3*012; KIR3DL3*01402; KIR3DL3*01403; KIR3DL3*01403-v; KIR3DL3*01404; KIR3DL3*01406; KIR3DL3*01601; KIR3DL3*020; KIR3DL3*02801; KIR3DL3*034; KIR3DL3*050; KIR3DL3*071-v; killer cell Ig-like receptor KIR3DL7; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 3; killer cell inhibitory receptor 1; killer-cell immunoglobulin-like receptor 3DL3
• Gene ID: 115653
• mRNA Refseq: NM_153443
• Protein Refseq: NP_703144
• MIM: 610095
• UniProt ID: Q8N743