Recombinant Human KIT protein, His-tagged
| Cat.No. : | KIT-2761H |
| Product Overview : | Recombinant Human KIT protein(), fused to His tag, was expressed in E. coli. |
| Availability | November 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | KIT |
| Synonyms | KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit; |
| Gene ID | 3815 |
| mRNA Refseq | NM_000222 |
| Protein Refseq | NP_000213 |
| MIM | 164920 |
| UniProt ID | P10721 |
| ◆ Recombinant Proteins | ||
| KIT-3708H | Recombinant Human KIT protein, rFc-tagged | +Inquiry |
| KIT-1138M | Recombinant Mouse KIT protein(Met1-Thr523), His-tagged | +Inquiry |
| Kit-8773RAF555 | Recombinant Rat Kit Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| KIT-160H | Recombinant Human KIT protein, DDK/His-tagged | +Inquiry |
| KIT-87H | Active Recombinant Human c-KIT Mutant (N822K), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KIT-2114MCL | Recombinant Mouse KIT cell lysate | +Inquiry |
| KIT-1324RCL | Recombinant Rat KIT cell lysate | +Inquiry |
| KIT-463HCL | Recombinant Human KIT cell lysate | +Inquiry |
| KIT-001HCL | Recombinant Human KIT cell lysate | +Inquiry |
| KIT-1405RCL | Recombinant Rat KIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIT Products
Required fields are marked with *
My Review for All KIT Products
Required fields are marked with *
