Recombinant Human KITLG Protein
Cat.No. : | KITLG-525H |
Product Overview : | Recombinant human KITLG protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 273 |
Description : | This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
AA Sequence : | MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
Kitl-501M | Active Recombinant Mouse Interleukin Kitl, MIgG2a Fc-tagged, mutant | +Inquiry |
KITL-154M | Recombinant Mouse KITL Protein | +Inquiry |
KITLG-1245H | Recombinant Human KIT Ligand | +Inquiry |
KITLG-4355S | Recombinant Swine KITLG Protein | +Inquiry |
KITLG-961H | Active Recombinant Human KITLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket