Recombinant Human KITLG Protein
| Cat.No. : | KITLG-525H |
| Product Overview : | Recombinant human KITLG protein |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Protein Length : | 273 |
| Description : | This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized |
| AA Sequence : | MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
| Official Symbol | KITLG |
| Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
| Gene ID | 4254 |
| mRNA Refseq | NM_000899 |
| Protein Refseq | NP_000890 |
| MIM | 184745 |
| UniProt ID | P21583 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *



