Recombinant Human KITLG protein, GST-tagged
| Cat.No. : | KITLG-3136H |
| Product Overview : | Recombinant Human KITLG protein(P21583)(26-189aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 26-189aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.5 kDa |
| AA Sequence : | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KITLG KIT ligand [ Homo sapiens ] |
| Official Symbol | KITLG |
| Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
| Gene ID | 4254 |
| mRNA Refseq | NM_000899 |
| Protein Refseq | NP_000890 |
| MIM | 184745 |
| UniProt ID | P21583 |
| ◆ Recombinant Proteins | ||
| KITLG-2056H | Recombinant Human KITLG Protein, His-tagged | +Inquiry |
| KITLG-3136H | Recombinant Human KITLG protein, GST-tagged | +Inquiry |
| Kitl-577M | Recombinant Mouse Kitl protein, His-tagged, Biotinylated. | +Inquiry |
| Kitlg-62R | Recombinant Rat Kit Ligand | +Inquiry |
| KITL-526M | Recombinant Mouse KITL Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
| KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
