Recombinant Human KLC1 protein, GST-tagged
| Cat.No. : | KLC1-5849H |
| Product Overview : | Recombinant Human KLC1 protein(1-290 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-290 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KLC1 kinesin light chain 1 [ Homo sapiens ] |
| Official Symbol | KLC1 |
| Synonyms | KLC1; kinesin light chain 1; kinesin 2 , kinesin 2 60/70kDa , KNS2; hKLC1B; hKLC1G; hKLC1J; hKLC1N; hKLC1P; hKLC1R; hKLC1S; KLC; KNS2A; KLC 1; kinesin 2 60/70kDa; medulloblastoma antigen MU-MB-2.50; KNS2; MGC15245; |
| Gene ID | 3831 |
| mRNA Refseq | NM_001130107 |
| Protein Refseq | NP_001123579 |
| MIM | 600025 |
| UniProt ID | Q07866 |
| ◆ Recombinant Proteins | ||
| KLC1-3267R | Recombinant Rat KLC1 Protein | +Inquiry |
| KLC1-2923R | Recombinant Rat KLC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLC1-7881H | Recombinant Human KLC1 protein, His & T7-tagged | +Inquiry |
| KLC1-27879TH | Recombinant Human KLC1, His-tagged | +Inquiry |
| KLC1-2736H | Recombinant Human KLC1 Protein (Met1-Val254), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLC1-4935HCL | Recombinant Human KLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLC1 Products
Required fields are marked with *
My Review for All KLC1 Products
Required fields are marked with *
