Recombinant Human KLC1 protein, GST-tagged
Cat.No. : | KLC1-5849H |
Product Overview : | Recombinant Human KLC1(1-290aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-290aa |
Description : | Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
AA Sequence : | MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKS LEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEF MNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLG |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | KLC1 kinesin light chain 1 [ Homo sapiens ] |
Official Symbol | KLC1 |
Synonyms | KLC1; kinesin light chain 1; kinesin 2 , kinesin 2 60/70kDa , KNS2; hKLC1B; hKLC1G; hKLC1J; hKLC1N; hKLC1P; hKLC1R; hKLC1S; KLC; KNS2A; KLC 1; kinesin 2 60/70kDa; medulloblastoma antigen MU-MB-2.50; KNS2; MGC15245; |
Gene ID | 3831 |
mRNA Refseq | NM_001130107 |
Protein Refseq | NP_001123579 |
MIM | 600025 |
UniProt ID | Q07866 |
Chromosome Location | 14q32.3 |
Pathway | Arf6 trafficking events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; |
Function | microtubule motor activity; motor activity; protein binding; |
◆ Recombinant Proteins | ||
KLC1-7881H | Recombinant Human KLC1 protein, His & T7-tagged | +Inquiry |
KLC1-2736H | Recombinant Human KLC1 Protein (Met1-Val254), N-His tagged | +Inquiry |
KLC1-5849H | Recombinant Human KLC1 protein, GST-tagged | +Inquiry |
KLC1-2923R | Recombinant Rat KLC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLC1-3267R | Recombinant Rat KLC1 Protein | +Inquiry |
◆ Native Proteins | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLC1-4935HCL | Recombinant Human KLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLC1 Products
Required fields are marked with *
My Review for All KLC1 Products
Required fields are marked with *