Recombinant Human KLC3 protein, GST-tagged
Cat.No. : | KLC3-301134H |
Product Overview : | Recombinant Human KLC3 (1-196 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Pro196 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQVPRAGRGGGCWALHRAPQSPRPSLESHSPQDPP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | KLC3 kinesin light chain 3 [ Homo sapiens ] |
Official Symbol | KLC3 |
Synonyms | KLC3; kinesin light chain 3; KLC2L; KLCt; KNS2B; kinesin light chain 2; KLC2; |
Gene ID | 147700 |
mRNA Refseq | NM_177417 |
Protein Refseq | NP_803136 |
MIM | 601334 |
UniProt ID | Q6P597 |
◆ Recombinant Proteins | ||
KLC3-3268R | Recombinant Rat KLC3 Protein | +Inquiry |
KLC3-301134H | Recombinant Human KLC3 protein, GST-tagged | +Inquiry |
Klc3-3699M | Recombinant Mouse Klc3 Protein, Myc/DDK-tagged | +Inquiry |
KLC3-8671M | Recombinant Mouse KLC3 Protein | +Inquiry |
KLC3-3281H | Recombinant Human KLC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLC3-937HCL | Recombinant Human KLC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLC3 Products
Required fields are marked with *
My Review for All KLC3 Products
Required fields are marked with *
0
Inquiry Basket