Recombinant Human KLF15 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KLF15-3502H |
Product Overview : | KLF15 MS Standard C13 and N15-labeled recombinant protein (NP_054798) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of cardiac fibrosis. It is also involved in the control of cardiac hypertrophy acting through the inhibition of MEF2A and GATA4 (By similarity). Involved in podocyte differentiation (By similarity). Inhibits MYOCD activity. Is a negative regulator of TP53 acetylation. Inhibits NF-kappa-B activation through repression of EP300-dependent RELA acetylation. |
Molecular Mass : | 44 kDa |
AA Sequence : | MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KLF15 Kruppel-like factor 15 [ Homo sapiens (human) ] |
Official Symbol | KLF15 |
Synonyms | KLF15; Kruppel-like factor 15; Krueppel-like factor 15; kidney enriched Kruppel like factor; KKLF; kidney-enriched Kruppel-like factor; kidney-enriched krueppel-like factor; DKFZp779M1320; |
Gene ID | 28999 |
mRNA Refseq | NM_014079 |
Protein Refseq | NP_054798 |
MIM | 606465 |
UniProt ID | Q9UIH9 |
◆ Recombinant Proteins | ||
Klf15-3702M | Recombinant Mouse Klf15 Protein, Myc/DDK-tagged | +Inquiry |
KLF15-12016Z | Recombinant Zebrafish KLF15 | +Inquiry |
KLF15-8679M | Recombinant Mouse KLF15 Protein | +Inquiry |
KLF15-4838M | Recombinant Mouse KLF15 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLF15-3502H | Recombinant Human KLF15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF15-4930HCL | Recombinant Human KLF15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLF15 Products
Required fields are marked with *
My Review for All KLF15 Products
Required fields are marked with *
0
Inquiry Basket