Recombinant Human KLF17 protein, T7/His-tagged
Cat.No. : | KLF17-169H |
Product Overview : | Recombinant human KLF17 cDNA (389aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGV HTSWNQGLPTIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQ EMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPSGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVP STEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGT GRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQ CSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | KLF17 Kruppel-like factor 17 [ Homo sapiens ] |
Official Symbol | KLF17 |
Synonyms | KLF17; Kruppel-like factor 17; FLJ40160; Zfp393; zinc finger protein 393; novel zinc-finger protein; ZNF393; RP4-675G8.1; |
Gene ID | 128209 |
mRNA Refseq | NM_173484 |
Protein Refseq | NP_775755 |
MIM | 609602 |
UniProt ID | Q5JT82 |
Chromosome Location | 1p34.1 |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; zinc ion binding; |
◆ Recombinant Proteins | ||
KLF17-8681M | Recombinant Mouse KLF17 Protein | +Inquiry |
KLF17-169H | Recombinant Human KLF17 protein, T7/His-tagged | +Inquiry |
KLF17-4839M | Recombinant Mouse KLF17 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLF17-9244Z | Recombinant Zebrafish KLF17 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF17-4929HCL | Recombinant Human KLF17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLF17 Products
Required fields are marked with *
My Review for All KLF17 Products
Required fields are marked with *
0
Inquiry Basket