Recombinant Human KLF4 protein, His-tagged
Cat.No. : | KLF4-5633H |
Product Overview : | Recombinant Human KLF4 protein(204-504 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 204-504 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | IPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KLF4 Kruppel-like factor 4 (gut) [ Homo sapiens ] |
Official Symbol | KLF4 |
Synonyms | KLF4; Kruppel-like factor 4 (gut); Krueppel-like factor 4; EZF; GKLF; gut-enriched krueppel-like factor; epithelial zinc finger protein EZF; endothelial Kruppel-like zinc finger protein; |
Gene ID | 9314 |
mRNA Refseq | NM_004235 |
Protein Refseq | NP_004226 |
MIM | 602253 |
UniProt ID | O43474 |
◆ Recombinant Proteins | ||
KLF4-6294Z | Recombinant Zebrafish KLF4 | +Inquiry |
KLF4-3567H | Recombinant Human KLF4, His CaM-tagged | +Inquiry |
KLF4-29901TH | Recombinant Human KLF4 | +Inquiry |
KLF4-145H | Recombinant Human KLF4 Protein, 13-residue TAT-tagged | +Inquiry |
KLF4-29898TH | Recombinant Human KLF4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF4-4927HCL | Recombinant Human KLF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLF4 Products
Required fields are marked with *
My Review for All KLF4 Products
Required fields are marked with *