Recombinant Human KLF6 protein, GST-tagged
Cat.No. : | KLF6-1865H |
Product Overview : | Recombinant Human KLF6 protein(1-283 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-283 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KLF6 Kruppel-like factor 6 [ Homo sapiens ] |
Official Symbol | KLF6 |
Synonyms | KLF6; Kruppel-like factor 6; BCD1, COPEB, core promoter element binding protein , ST12; Krueppel-like factor 6; CPBP; GBF; GC rich binding factor; PAC1; Zf9; proto-oncogene BCD1; GC-rich binding factor; B-cell-derived protein 1; transcription factor Zf9; protooncogene B-cell derived 1; GC-rich sites-binding factor GBF; Kruppel-like zinc finger protein Zf9; core promoter element binding protein; core promoter element-binding protein; suppressor of tumorigenicity 12 protein; suppression of tumorigenicity 12 (prostate); ZF9; BCD1; CBA1; ST12; COPEB; DKFZp686N0199; |
Gene ID | 1316 |
mRNA Refseq | NM_001160124 |
Protein Refseq | NP_001153596 |
MIM | 602053 |
UniProt ID | Q99612 |
◆ Recombinant Proteins | ||
KLF6-2656C | Recombinant Chicken KLF6 | +Inquiry |
KLF6-844H | Recombinant Human KLF6 Protein, His-tagged | +Inquiry |
KLF6-2809H | Recombinant Human KLF6 Protein (Met1-Ser109) | +Inquiry |
KLF6-5054H | Recombinant Human KLF6, His-tagged | +Inquiry |
KLF6-843H | Recombinant Human KLF6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF6-4926HCL | Recombinant Human KLF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLF6 Products
Required fields are marked with *
My Review for All KLF6 Products
Required fields are marked with *