Recombinant Human KLF9 protein, His-tagged

Cat.No. : KLF9-7444H
Product Overview : Recombinant Human KLF9 protein(1-150 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-150 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name KLF9 Kruppel-like factor 9 [ Homo sapiens ]
Official Symbol KLF9
Synonyms KLF9; Kruppel-like factor 9; basic transcription element binding protein 1 , BTEB1; Krueppel-like factor 9; BTE-binding protein 1; GC-box-binding protein 1; transcription factor BTEB1; basic transcription element binding protein 1; basic transcription element-binding protein 1; BTEB; BTEB1;
Gene ID 687
mRNA Refseq NM_001206
Protein Refseq NP_001197
MIM 602902
UniProt ID Q13886

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLF9 Products

Required fields are marked with *

My Review for All KLF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon