Recombinant Human KLF9 protein, His-tagged

• Cat.No.: KLF9-7444H
• Product Overview: Recombinant Human KLF9 protein(1-150 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-150 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: KLF9 Kruppel-like factor 9 [ Homo sapiens ]
• Official Symbol: KLF9
• Synonyms: KLF9; Kruppel-like factor 9; basic transcription element binding protein 1 , BTEB1; Krueppel-like factor 9; BTE-binding protein 1; GC-box-binding protein 1; transcription factor BTEB1; basic transcription element binding protein 1; basic transcription element-binding protein 1; BTEB; BTEB1
• Gene ID: 687
• mRNA Refseq: NM_001206
• Protein Refseq: NP_001197
• MIM: 602902
• UniProt ID: Q13886