Recombinant Human KLHL3 protein, GST-tagged
Cat.No. : | KLHL3-109H |
Product Overview : | Recombinant Human KLHL3 protein(1-301 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-301 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KLHL3 kelch-like 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | KLHL3 |
Synonyms | KLHL3; kelch-like 3 (Drosophila); kelch (Drosophila) like 3; kelch-like protein 3; KIAA1129; PHA2D; FLJ40871; MGC44594; |
Gene ID | 26249 |
mRNA Refseq | NM_001257194 |
Protein Refseq | NP_001244123 |
MIM | 605775 |
UniProt ID | Q9UH77 |
◆ Recombinant Proteins | ||
KLHL3-2428R | Recombinant Rhesus monkey KLHL3 Protein, His-tagged | +Inquiry |
KLHL3-1239H | Recombinant Human KLHL3 Protein (E2-L587), Tag Free | +Inquiry |
KLHL3-109H | Recombinant Human KLHL3 protein, GST-tagged | +Inquiry |
KLHL3-1410H | Recombinant Human KLHL3 protein, His-tagged | +Inquiry |
KLHL3-1136HFL | Recombinant Full Length Human KLHL3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL3-4908HCL | Recombinant Human KLHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHL3 Products
Required fields are marked with *
My Review for All KLHL3 Products
Required fields are marked with *