Recombinant Human KLHL32 protein, GST-tagged

• Cat.No.: KLHL32-301521H
• Product Overview: Recombinant Human KLHL32 (169-318 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Lys169-Ala318
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KLHL32 kelch-like 32 (Drosophila) [ Homo sapiens ]
• Official Symbol: KLHL32
• Synonyms: KLHL32; kelch-like 32 (Drosophila); BKLHD5, BTB and kelch domain containing 5 , KIAA1900; kelch-like protein 32; BTB and kelch domain containing 5; BTB and kelch domain-containing protein 5; BKLHD5; KIAA1900; dJ21F7.1; UG0030H05; RP1-39B17.1; MGC51280; MGC87753
• Gene ID: 114792
• mRNA Refseq: NM_052904
• Protein Refseq: NP_443136
• UniProt ID: Q96NJ5