Recombinant Human KLHL32 protein, GST-tagged

Cat.No. : KLHL32-301521H
Product Overview : Recombinant Human KLHL32 (169-318 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Lys169-Ala318
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : KHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name KLHL32 kelch-like 32 (Drosophila) [ Homo sapiens ]
Official Symbol KLHL32
Synonyms KLHL32; kelch-like 32 (Drosophila); BKLHD5, BTB and kelch domain containing 5 , KIAA1900; kelch-like protein 32; BTB and kelch domain containing 5; BTB and kelch domain-containing protein 5; BKLHD5; KIAA1900; dJ21F7.1; UG0030H05; RP1-39B17.1; MGC51280; MGC87753;
Gene ID 114792
mRNA Refseq NM_052904
Protein Refseq NP_443136
UniProt ID Q96NJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLHL32 Products

Required fields are marked with *

My Review for All KLHL32 Products

Required fields are marked with *

0
cart-icon
0
compare icon