Recombinant Human KLK1 protein, His-SUMO-tagged
Cat.No. : | KLK1-3137H |
Product Overview : | Recombinant Human KLK1 protein(P06870)(25-262aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-262aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KLK1 kallikrein 1 [ Homo sapiens ] |
Official Symbol | KLK1 |
Synonyms | KLK1; kallikrein 1; kallikrein 1, renal/pancreas/salivary; kallikrein-1; Klk6; tissue kallikrein; glandular kallikrein 1; kallikrein serine protease 1; kidney/pancreas/salivary gland kallikrein; hK1; KLKR; |
Gene ID | 3816 |
mRNA Refseq | NM_002257 |
Protein Refseq | NP_002248 |
UniProt ID | P06870 |
◆ Recombinant Proteins | ||
KLK1-3228H | Recombinant Human KLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK1-29686TH | Recombinant Human KLK1 | +Inquiry |
KLK1-38H | Recombinant Human Kallikrein 1 | +Inquiry |
KLK1-7198H | Recombinant Human Kallikrein 1, His-tagged | +Inquiry |
KLK1-727H | Recombinant Human KLK1 Protein, GST-His-tagged | +Inquiry |
◆ Native Proteins | ||
KLK1-29685TH | Native Human KLK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK1-743MCL | Recombinant Mouse KLK1 cell lysate | +Inquiry |
KLK1-2901HCL | Recombinant Human KLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK1 Products
Required fields are marked with *
My Review for All KLK1 Products
Required fields are marked with *