Recombinant Human KLK2, His-tagged

Cat.No. : KLK2-122H
Product Overview : Recombinant Human Kallikrein 2/KLK2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro19-Pro261) of Human KLK2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-261 a.a.
Description : Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.
Form : Supplied as a 0.2 μM filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5
AA Sequence : PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEP EDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPAL GTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDS GGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name KLK2 kallikrein-related peptidase 2 [ Homo sapiens ]
Official Symbol KLK2
Synonyms KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201;
Gene ID 3817
mRNA Refseq NM_001002231
Protein Refseq NP_001002231
MIM 147960
UniProt ID P20151
Chromosome Location 19q13.33
Pathway Activation of Matrix Metalloproteinases, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Extracellular matrix organization, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK2 Products

Required fields are marked with *

My Review for All KLK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon