Recombinant Human KLK5 protein, His-tagged
Cat.No. : | KLK5-26H |
Product Overview : | Recombinant Human KLK5(Val23-Ser293) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 23-293 a.a. |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5. |
AA Sequence : | VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLR PNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSN DLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRC EDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFT KWIQETIQANSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | KLK5 kallikrein-related peptidase 5 [ Homo sapiens ] |
Official Symbol | KLK5 |
Synonyms | KLK5; kallikrein-related peptidase 5; kallikrein 5; kallikrein-5; KLK L2; SCTE; kallikrein-like protein 2; stratum corneum tryptic enzyme; KLKL2; KLK-L2; |
Gene ID | 25818 |
mRNA Refseq | NM_001077491 |
Protein Refseq | NP_001070959 |
MIM | 605643 |
UniProt ID | Q9Y337 |
Chromosome Location | 19q13.33 |
Function | peptidase activity; protein binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
KLK5-27H | Active Recombinant Human KLK5 protein, GGS-8H-tagged | +Inquiry |
KLK5-4934H | Recombinant Human KLK5 Protein, GST-tagged | +Inquiry |
Klk5-1978M | Active Recombinant Mouse Kallikrein Related-Peptidase 5, His-tagged | +Inquiry |
KLK5-2433R | Recombinant Rhesus monkey KLK5 Protein, His-tagged | +Inquiry |
KLK5-4171H | Recombinant Human KLK5 Protein (IIe67-Ser293), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK5-948HCL | Recombinant Human KLK5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK5 Products
Required fields are marked with *
My Review for All KLK5 Products
Required fields are marked with *