Recombinant Human KLK7 protein, GST-tagged
| Cat.No. : | KLK7-3139H |
| Product Overview : | Recombinant Human KLK7 protein(P49862)(28-253aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 28-253aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KLK7 kallikrein-related peptidase 7 [ Homo sapiens ] |
| Official Symbol | KLK7 |
| Synonyms | KLK7; kallikrein-related peptidase 7; kallikrein 7 (chymotryptic, stratum corneum) , PRSS6; kallikrein-7; SCCE; signal protein; serine protease 6; stratum corneum chymotryptic enzyme; kallikrein 7 (chymotryptic, stratum corneum); hK7; PRSS6; |
| Gene ID | 5650 |
| mRNA Refseq | NM_001243126 |
| Protein Refseq | NP_001230055 |
| MIM | 604438 |
| UniProt ID | P49862 |
| ◆ Recombinant Proteins | ||
| Klk7-3726M | Recombinant Mouse Klk7 Protein, Myc/DDK-tagged | +Inquiry |
| Klk7-7405M | Active Recombinant Mouse Klk7 protein, His-tagged | +Inquiry |
| KLK7-5458H | Recombinant Human KLK7 protein, His-tagged | +Inquiry |
| KLK7-3139H | Recombinant Human KLK7 protein, GST-tagged | +Inquiry |
| KLK7-5864HF | Recombinant Full Length Human KLK7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLK7-1421MCL | Recombinant Mouse KLK7 cell lysate | +Inquiry |
| KLK7-2428HCL | Recombinant Human KLK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK7 Products
Required fields are marked with *
My Review for All KLK7 Products
Required fields are marked with *
