Recombinant Human KLK8 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KLK8-480H |
| Product Overview : | KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KLK8 kallikrein-related peptidase 8 [ Homo sapiens (human) ] |
| Official Symbol | KLK8 |
| Synonyms | KLK8; kallikrein-related peptidase 8; kallikrein 8 (neuropsin/ovasin), PRSS19; kallikrein-8; HNP; neuropsin; ovasin; TADG14; hK8; neuropsin type 1; neuropsin type 2; serine protease 19; KLK8 protein type 1; KLK8 protein type 2; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein; NP; NRPN; PRSS19; |
| Gene ID | 11202 |
| mRNA Refseq | NM_007196 |
| Protein Refseq | NP_009127 |
| MIM | 605644 |
| UniProt ID | O60259 |
| ◆ Recombinant Proteins | ||
| KLK8-4928H | Recombinant Human KLK8 Protein, GST-tagged | +Inquiry |
| KLK8-688H | Recombinant Human KLK8 Protein, MYC/DDK-tagged | +Inquiry |
| KLK8-1166H | Active Recombinant Human KLK8, His tagged | +Inquiry |
| KLK8-4881M | Recombinant Mouse KLK8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Klk8-799R | Recombinant Rat Klk8 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLK8-1985HCL | Recombinant Human KLK8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK8 Products
Required fields are marked with *
My Review for All KLK8 Products
Required fields are marked with *



