Recombinant Human KLK8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KLK8-480H
Product Overview : KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Molecular Mass : 28.1 kDa
AA Sequence : MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KLK8 kallikrein-related peptidase 8 [ Homo sapiens (human) ]
Official Symbol KLK8
Synonyms KLK8; kallikrein-related peptidase 8; kallikrein 8 (neuropsin/ovasin), PRSS19; kallikrein-8; HNP; neuropsin; ovasin; TADG14; hK8; neuropsin type 1; neuropsin type 2; serine protease 19; KLK8 protein type 1; KLK8 protein type 2; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein; NP; NRPN; PRSS19;
Gene ID 11202
mRNA Refseq NM_007196
Protein Refseq NP_009127
MIM 605644
UniProt ID O60259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK8 Products

Required fields are marked with *

My Review for All KLK8 Products

Required fields are marked with *

0
cart-icon