Recombinant Human KLRC2 Protein (94-231 aa), His-SUMO-tagged
Cat.No. : | KLRC2-606H |
Product Overview : | Recombinant Human KLRC2 Protein (94-231 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 94-231 aa |
Description : | Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 31.8 kDa |
AA Sequence : | IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | KLRC2 killer cell lectin-like receptor subfamily C, member 2 [ Homo sapiens ] |
Official Symbol | KLRC2 |
Synonyms | KLRC2; CD159c; NKG2 C; NK cell receptor C; NKG2C; NKG2-C; MGC138244; |
Gene ID | 3822 |
mRNA Refseq | NM_002260 |
Protein Refseq | NP_002251 |
MIM | 602891 |
UniProt ID | P26717 |
◆ Recombinant Proteins | ||
KLRC2-1704H | Recombinant Human KLRC2 protein, hFc-tagged | +Inquiry |
KLRC2-5900HF | Recombinant Full Length Human KLRC2 Protein | +Inquiry |
KLRC2-194H | Recombinant Human KLRC2 and CD94 Protein, Glu98-Leu231 and Ser34-Ile179, N-His-Avi tagged, Biotinylated | +Inquiry |
KLRC2-195H | Recombinant Human KLRC2 Protein, Glu98-Leu231, N-His-Avi tagged, Biotinylated | +Inquiry |
KLRC2-0578H | Recombinant Human KLRC2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRC2-4895HCL | Recombinant Human KLRC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRC2 Products
Required fields are marked with *
My Review for All KLRC2 Products
Required fields are marked with *