Recombinant Human KLRC2 Protein (94-231 aa), His-SUMO-tagged

• Cat.No.: KLRC2-606H
• Product Overview: Recombinant Human KLRC2 Protein (94-231 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 94-231 aa
• Description: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: KLRC2 killer cell lectin-like receptor subfamily C, member 2 [ Homo sapiens ]
• Official Symbol: KLRC2
• Synonyms: KLRC2; CD159c; NKG2 C; NK cell receptor C; NKG2C; NKG2-C; MGC138244
• Gene ID: 3822
• mRNA Refseq: NM_002260
• Protein Refseq: NP_002251
• MIM: 602891
• UniProt ID: P26717