Recombinant Human KLRC2 Protein (94-231 aa), His-SUMO-tagged

Cat.No. : KLRC2-606H
Product Overview : Recombinant Human KLRC2 Protein (94-231 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 94-231 aa
Description : Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 31.8 kDa
AA Sequence : IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name KLRC2 killer cell lectin-like receptor subfamily C, member 2 [ Homo sapiens ]
Official Symbol KLRC2
Synonyms KLRC2; CD159c; NKG2 C; NK cell receptor C; NKG2C; NKG2-C; MGC138244;
Gene ID 3822
mRNA Refseq NM_002260
Protein Refseq NP_002251
MIM 602891
UniProt ID P26717

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRC2 Products

Required fields are marked with *

My Review for All KLRC2 Products

Required fields are marked with *

0
cart-icon