Recombinant Human KLRC3

• Cat.No.: KLRC3-29905TH
• Product Overview: Recombinant fragment of Human KLRC3 with a N terminal proprietary tag; Predicted MWt 37.62 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 109 amino acids
• Description: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Weight: 37.620kDa inclusive of tags
• Tissue specificity: Natural killer cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPS SWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLH VRGLISDQCGSSRIIRRGFIMLTRLVLNS
• Sequence Similarities: Contains 1 C-type lectin domain.

Gene Information

• Gene Name: KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ]
• Official Symbol: KLRC3
• Synonyms: KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E
• Gene ID: 3823
• mRNA Refseq: NM_002261
• Protein Refseq: NP_002252
• MIM: 602892
• Uniprot ID: Q07444
• Chromosome Location: 12p13
• Pathway: Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem
• Function: binding; receptor activity; sugar binding; transmembrane signaling receptor activity