Recombinant Human KLRC3

Cat.No. : KLRC3-29905TH
Product Overview : Recombinant fragment of Human KLRC3 with a N terminal proprietary tag; Predicted MWt 37.62 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight : 37.620kDa inclusive of tags
Tissue specificity : Natural killer cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPS SWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLH VRGLISDQCGSSRIIRRGFIMLTRLVLNS
Sequence Similarities : Contains 1 C-type lectin domain.
Gene Name KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ]
Official Symbol KLRC3
Synonyms KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E;
Gene ID 3823
mRNA Refseq NM_002261
Protein Refseq NP_002252
MIM 602892
Uniprot ID Q07444
Chromosome Location 12p13
Pathway Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function binding; receptor activity; sugar binding; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRC3 Products

Required fields are marked with *

My Review for All KLRC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon