Recombinant Human KLRC3
| Cat.No. : | KLRC3-29905TH |
| Product Overview : | Recombinant fragment of Human KLRC3 with a N terminal proprietary tag; Predicted MWt 37.62 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 109 amino acids |
| Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Weight : | 37.620kDa inclusive of tags |
| Tissue specificity : | Natural killer cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPS SWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLH VRGLISDQCGSSRIIRRGFIMLTRLVLNS |
| Sequence Similarities : | Contains 1 C-type lectin domain. |
| Gene Name | KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ] |
| Official Symbol | KLRC3 |
| Synonyms | KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E; |
| Gene ID | 3823 |
| mRNA Refseq | NM_002261 |
| Protein Refseq | NP_002252 |
| MIM | 602892 |
| Uniprot ID | Q07444 |
| Chromosome Location | 12p13 |
| Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
| Function | binding; receptor activity; sugar binding; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| KLRC3-2437R | Recombinant Rhesus monkey KLRC3 Protein, His-tagged | +Inquiry |
| KLRC3-2258R | Recombinant Rhesus Macaque KLRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLRC3-29905TH | Recombinant Human KLRC3 | +Inquiry |
| KLRC3-7170H | Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3, His-tagged | +Inquiry |
| KLRC3-4913H | Recombinant Human KLRC3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRC3 Products
Required fields are marked with *
My Review for All KLRC3 Products
Required fields are marked with *



