Recombinant Human KLRC3 Protein, GST-tagged
Cat.No. : | KLRC3-4913H |
Product Overview : | Human KLRC3 partial ORF ( NP_002252, 132 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ] |
Official Symbol | KLRC3 |
Synonyms | KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E; NK cell receptor E; NKG2-E-activating NK receptor; NKG2E; NKG2-E; |
Gene ID | 3823 |
mRNA Refseq | NM_002261 |
Protein Refseq | NP_002252 |
MIM | 602892 |
UniProt ID | Q07444 |
◆ Recombinant Proteins | ||
KLRC3-4913H | Recombinant Human KLRC3 Protein, GST-tagged | +Inquiry |
KLRC3-7170H | Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3, His-tagged | +Inquiry |
KLRC3-29905TH | Recombinant Human KLRC3 | +Inquiry |
KLRC3-2437R | Recombinant Rhesus monkey KLRC3 Protein, His-tagged | +Inquiry |
KLRC3-2258R | Recombinant Rhesus Macaque KLRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRC3 Products
Required fields are marked with *
My Review for All KLRC3 Products
Required fields are marked with *