Recombinant Human KPNA5 protein, GST-tagged
| Cat.No. : | KPNA5-5325H |
| Product Overview : | Recombinant Human KPNA5 protein(1-231 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-231 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KPNA5 karyopherin alpha 5 (importin alpha 6) [ Homo sapiens ] |
| Official Symbol | KPNA5 |
| Synonyms | KPNA5; karyopherin alpha 5 (importin alpha 6); importin subunit alpha-6; IPOA6; SRP6; importin alpha 6; karyopherin subunit alpha-5; |
| Gene ID | 3841 |
| mRNA Refseq | NM_002269 |
| Protein Refseq | NP_002260 |
| MIM | 604545 |
| UniProt ID | O15131 |
| ◆ Recombinant Proteins | ||
| KPNA5-5325H | Recombinant Human KPNA5 protein, GST-tagged | +Inquiry |
| KPNA5-2661Z | Recombinant Zebrafish KPNA5 | +Inquiry |
| KPNA5-29811TH | Recombinant Human KPNA5 | +Inquiry |
| KPNA5-2377H | Recombinant Human KPNA5 Protein, His-tagged | +Inquiry |
| KPNA5-274HF | Recombinant Full Length Human KPNA5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KPNA5-4888HCL | Recombinant Human KPNA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA5 Products
Required fields are marked with *
My Review for All KPNA5 Products
Required fields are marked with *
